LRRC15 anticorps (N-Term)

N° du produit ABIN635851

Cet anticorps Lapin Polyclonal détecte spécifiquement LRRC15 dans WB. Il présente une réactivité envers Humain et Rat.

Aperçu rapide pour LRRC15 anticorps (N-Term) (ABIN635851)

Antigène: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRRC15 anticorps

Épitope: N-Term

Specificité: LRRC15 antibody was raised against the N terminal of LRRC15

Purification: Affinity purified

Immunogène: LRRC15 antibody was raised using the N terminal of LRRC15 corresponding to a region with amino acids LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC15 Blocking Peptide, (ABIN5614568), is also available for use as a blocking control in assays to test for specificity of this LRRC15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC15

Antigène: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Autre désignation: LRRC15

Sujet: LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.

Poids moléculaire: 64 kDa (MW of target protein)