LRRC15 anticorps (N-Term)

N° du produit ABIN635851

Détail du produit anti-LRRC15 anticorps

Antigène: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC15 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC15 antibody was raised against the N terminal of LRRC15

Purification: Affinity purified

Immunogène: LRRC15 antibody was raised using the N terminal of LRRC15 corresponding to a region with amino acids LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC15 Blocking Peptide, catalog no. 33R-5224, is also available for use as a blocking control in assays to test for specificity of this LRRC15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC15

Antigène: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Autre désignation: LRRC15 (LRRC15 Produits)

Synonymes: anticorps cb894, anticorps zgc:158286, anticorps LIB, anticorps 5430427N11Rik, anticorps Lib, anticorps leucine rich repeat containing 15, anticorps leucine-rich repeat-containing protein 15, anticorps carboxypeptidase N subunit 2, anticorps LRRC15, anticorps lrrc15, anticorps CpipJ_CPIJ004946, anticorps CpipJ_CPIJ005191, anticorps CpipJ_CPIJ007745, anticorps CPN2, anticorps Lrrc15

Sujet: LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.

Poids moléculaire: 64 kDa (MW of target protein)