CA4 anticorps (C-Term)

N° du produit ABIN635852

L’anticorps anti-CA4 Polyclonal Lapin est utilisé pour la détection de CA4 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour CA4 anticorps (C-Term) (ABIN635852)

Antigène: CA4 (Carbonic Anhydrase IV (CA4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CA4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CA4 anticorps

Épitope: C-Term

Specificité: Carbonic Anhydrase IV antibody was raised against the C terminal of CA4

Purification: Affinity purified

Immunogène: Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carbonic Anhydrase IV Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CA4

Antigène: CA4 (Carbonic Anhydrase IV (CA4))

Autre désignation: Carbonic Anhydrase IV

Sujet: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known.

Poids moléculaire: 34 kDa (MW of target protein)