SLC22A15 anticorps (Middle Region)

N° du produit ABIN635853

Détail du produit anti-SLC22A15 anticorps

Antigène: SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A15 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC22 A15 antibody was raised against the middle region of SLC22 15

Purification: Affinity purified

Immunogène: SLC22 A15 antibody was raised using the middle region of SLC22 15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A15 Blocking Peptide, catalog no. 33R-6840, is also available for use as a blocking control in assays to test for specificity of this SLC22A15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC22A15

Antigène: SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))

Autre désignation: SLC22A15 (SLC22A15 Produits)

Synonymes: anticorps FLIPT1, anticorps PRO34686, anticorps 2610034P21Rik, anticorps 4930477M19, anticorps A530052I06Rik, anticorps BB219042, anticorps solute carrier family 22 member 15, anticorps solute carrier family 22 (organic anion/cation transporter), member 15, anticorps solute carrier family 22, member 15, anticorps SLC22A15, anticorps Slc22a15

Sujet: Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites.

Poids moléculaire: 59 kDa (MW of target protein)