UGT1A7 anticorps (N-Term)

N° du produit ABIN635878

Détail du produit anti-UGT1A7 anticorps

Antigène: UGT1A7 (UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT1A7 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGT1 A7 antibody was raised against the N terminal of µgT1 7

Purification: Affinity purified

Immunogène: UGT1 A7 antibody was raised using the N terminal of µgT1 7 corresponding to a region with amino acids VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT1A7 Blocking Peptide, catalog no. 33R-9639, is also available for use as a blocking control in assays to test for specificity of this µgT1A7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT1A7

Antigène: UGT1A7 (UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7))

Autre désignation: UGT1A7 (UGT1A7 Produits)

Synonymes: anticorps UDPGT, anticorps UDPGT 1-7, anticorps UGT-1G, anticorps UGT1-07, anticorps UGT1.7, anticorps UGT1G, anticorps UGT1A10, anticorps UGT1A6, anticorps UGT1A7, anticorps UGT1A8, anticorps UGT1A9, anticorps UDP glucuronosyltransferase family 1 member A7, anticorps UDP glucuronosyltransferase family 1 member A1, anticorps UDP glucuronosyltransferase 1 family, polypeptide A7, anticorps UGT1A7, anticorps UGT1A1, anticorps ugt1a7

Sujet: UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha