NHE7 anticorps

N° du produit ABIN635882

L’anticorps anti-NHE7 Polyclonal Lapin est utilisé pour la détection de NHE7 dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour NHE7 anticorps (ABIN635882)

Antigène: NHE7 (SLC9A7) (Sodium Hydrogen Exchanger 7 (SLC9A7))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NHE7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NHE7 anticorps

Purification: Affinity purified

Immunogène: SLC9 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC9A7 Blocking Peptide, (ABIN940387), is also available for use as a blocking control in assays to test for specificity of this SLC9A7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NHE7

Antigène: NHE7 (SLC9A7) (Sodium Hydrogen Exchanger 7 (SLC9A7))

Autre désignation: SLC9A7

Sujet: Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.

Poids moléculaire: 80 kDa (MW of target protein)