AMIGO3 anticorps (N-Term)

N° du produit ABIN635891

L’anticorps Lapin Polyclonal anti-AMIGO3 a été validé pour WB. Il convient pour détecter AMIGO3 dans des échantillons de Humain.

Aperçu rapide pour AMIGO3 anticorps (N-Term) (ABIN635891)

Antigène: AMIGO3 (Adhesion Molecule with Ig-Like Domain 3 (AMIGO3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMIGO3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AMIGO3 anticorps

Épitope: N-Term

Specificité: AMIGO3 antibody was raised against the N terminal of AMIGO3

Purification: Affinity purified

Immunogène: AMIGO3 antibody was raised using the N terminal of AMIGO3 corresponding to a region with amino acids MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMIGO3 Blocking Peptide, (ABIN5612046), is also available for use as a blocking control in assays to test for specificity of this AMIGO3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMIGO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AMIGO3

Antigène: AMIGO3 (Adhesion Molecule with Ig-Like Domain 3 (AMIGO3))

Autre désignation: AMIGO3

Sujet: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.

Poids moléculaire: 55 kDa (MW of target protein)