EMID1 anticorps (C-Term)

N° du produit ABIN635896

Détail du produit anti-EMID1 anticorps

Antigène: EMID1 (EMI Domain Containing 1 (EMID1))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EMID1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EMID1 antibody was raised against the C terminal of EMID1

Purification: Affinity purified

Immunogène: EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EMID1 Blocking Peptide, catalog no. 33R-9201, is also available for use as a blocking control in assays to test for specificity of this EMID1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EMID1

Antigène: EMID1 (EMI Domain Containing 1 (EMID1))

Autre désignation: EMID1 (EMID1 Produits)

Synonymes: anticorps EMI5, anticorps EMU1, anticorps AW122071, anticorps CO-5, anticorps Emu1, anticorps RGD1565846, anticorps EMI domain containing 1, anticorps EMID1, anticorps Emid1

Sujet: EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.

Poids moléculaire: 45 kDa (MW of target protein)