RMDN3 anticorps (Middle Region)

N° du produit ABIN635897

Détail du produit anti-RMDN3 anticorps

Antigène: RMDN3 (FAM82A2) (Family with Sequence Similarity 82, Member A2 (FAM82A2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RMDN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM82 C antibody was raised against the middle region of Fam82

Purification: Affinity purified

Immunogène: FAM82 C antibody was raised using the middle region of Fam82 corresponding to a region with amino acids LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM82C Blocking Peptide, catalog no. 33R-5411, is also available for use as a blocking control in assays to test for specificity of this FAM82C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RMDN3

Antigène: RMDN3 (FAM82A2) (Family with Sequence Similarity 82, Member A2 (FAM82A2))

Autre désignation: FAM82C (FAM82A2 Produits)

Sujet: FAM82C may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82C protein induces apoptosis.

Poids moléculaire: 52 kDa (MW of target protein)