C2CD2L anticorps (C-Term)

N° du produit ABIN635898

Cet anticorps anti-C2CD2L est un anticorps Lapin Polyclonal détectant C2CD2L dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour C2CD2L anticorps (C-Term) (ABIN635898)

Antigène: C2CD2L (C2CD2-Like (C2CD2L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C2CD2L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C2CD2L anticorps

Épitope: C-Term

Specificité: TMEM24 antibody was raised against the C terminal Of Tmem24

Purification: Affinity purified

Immunogène: TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM24 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C2CD2L

Antigène: C2CD2L (C2CD2-Like (C2CD2L))

Autre désignation: TMEM24

Sujet: GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.

Poids moléculaire: 76 kDa (MW of target protein)