CLPTM1L anticorps (Middle Region)

N° du produit ABIN635900

Détail du produit anti-CLPTM1L anticorps

Antigène: CLPTM1L (CLPTM1-Like (CLPTM1L))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLPTM1L est non-conjugé

Application: Western Blotting (WB)

Specificité: CLPTM1 L antibody was raised against the middle region of CLPTM1

Purification: Affinity purified

Immunogène: CLPTM1 L antibody was raised using the middle region of CLPTM1 corresponding to a region with amino acids KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLPTM1L Blocking Peptide, catalog no. 33R-4238, is also available for use as a blocking control in assays to test for specificity of this CLPTM1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPTM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLPTM1L

Antigène: CLPTM1L (CLPTM1-Like (CLPTM1L))

Autre désignation: CLPTM1L (CLPTM1L Produits)

Synonymes: anticorps CRR9, anticorps C130052I12Rik, anticorps Crr9, anticorps RGD1307896, anticorps C130052I12RIK, anticorps CLPTM1 like, anticorps CLPTM1-like, anticorps cleft lip and palate transmembrane protein 1-like protein, anticorps CLPTM1L, anticorps clptm1l, anticorps LOC100338302, anticorps Clptm1l

Sujet: CLPTM1L enhances cisplatin-mediated apoptosis, when overexpressed.

Poids moléculaire: 62 kDa (MW of target protein)