TMEM123 anticorps (C-Term)

N° du produit ABIN635901

Détail du produit anti-TMEM123 anticorps

Antigène: TMEM123 (Transmembrane Protein 123 (TMEM123))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM123 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM123 antibody was raised against the C terminal of TMEM123

Purification: Affinity purified

Immunogène: TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM123 Blocking Peptide, catalog no. 33R-8860, is also available for use as a blocking control in assays to test for specificity of this TMEM123 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM123 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM123

Antigène: TMEM123 (Transmembrane Protein 123 (TMEM123))

Autre désignation: TMEM123 (TMEM123 Produits)

Synonymes: anticorps KCT3, anticorps PORIMIN, anticorps PORMIN, anticorps 2310075C12Rik, anticorps RGD1305625, anticorps kct3, anticorps pormin, anticorps porimin, anticorps transmembrane protein 123, anticorps transmembrane protein 123 L homeolog, anticorps TMEM123, anticorps Tmem123, anticorps tmem123.L, anticorps tmem123

Sujet: TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: Regulation of Cell Size