ACP2 anticorps (Middle Region)

N° du produit ABIN635914

Cet anticorps Lapin Polyclonal détecte spécifiquement ACP2 dans WB. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour ACP2 anticorps (Middle Region) (ABIN635914)

Antigène: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACP2 anticorps

Épitope: Middle Region

Specificité: ACP2 antibody was raised against the middle region of ACP2

Purification: Affinity purified

Immunogène: ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACP2 Blocking Peptide, (ABIN5611912), is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACP2

Antigène: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Autre désignation: ACP2

Sujet: ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.

Poids moléculaire: 45 kDa (MW of target protein)