ACP2 anticorps (Middle Region)

N° du produit ABIN635914

Détail du produit anti-ACP2 anticorps

Antigène: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACP2 antibody was raised against the middle region of ACP2

Purification: Affinity purified

Immunogène: ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACP2 Blocking Peptide, catalog no. 33R-9731, is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACP2

Antigène: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Autre désignation: ACP2 (ACP2 Produits)

Synonymes: anticorps ACP2, anticorps Acp-2, anticorps LAP, anticorps acid phosphatase 2, lysosomal, anticorps acid phosphatase 2, lysosomal S homeolog, anticorps ACP2, anticorps acp2, anticorps Acp2, anticorps acp2.S

Sujet: ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.

Poids moléculaire: 45 kDa (MW of target protein)