SLC8A3 anticorps

N° du produit ABIN635923

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC8A3 dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour SLC8A3 anticorps (ABIN635923)

Antigène: SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC8A3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC8A3 anticorps

Purification: Affinity purified

Immunogène: SLC8 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC8A3 Blocking Peptide, (ABIN5616280), is also available for use as a blocking control in assays to test for specificity of this SLC8A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC8A3

Antigène: SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))

Autre désignation: SLC8A3

Sujet: SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.

Poids moléculaire: 103 kDa (MW of target protein)