UGCG anticorps (N-Term)

N° du produit ABIN635932

Cet anticorps Lapin Polyclonal détecte spécifiquement UGCG dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour UGCG anticorps (N-Term) (ABIN635932)

Antigène: UGCG (UDP-Glucose Ceramide Glucosyltransferase (UGCG))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGCG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UGCG anticorps

Épitope: N-Term

Specificité: UGCG antibody was raised against the N terminal of µgCG

Purification: Affinity purified

Immunogène: UGCG antibody was raised using the N terminal of µgCG corresponding to a region with amino acids LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGCG Blocking Peptide, (ABIN940404), is also available for use as a blocking control in assays to test for specificity of this µgCG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGCG

Antigène: UGCG (UDP-Glucose Ceramide Glucosyltransferase (UGCG))

Autre désignation: UGCG

Sujet: Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes.

Poids moléculaire: 45 kDa (MW of target protein)