SLC13A2 anticorps

N° du produit ABIN635937

Détail du produit anti-SLC13A2 anticorps

Antigène: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC13A2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC13 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC13A2 Blocking Peptide, catalog no. 33R-7231, is also available for use as a blocking control in assays to test for specificity of this SLC13A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC13A2

Antigène: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Autre désignation: SLC13A2 (SLC13A2 Produits)

Synonymes: anticorps NADC1, anticorps NaCT, anticorps NaDC-1, anticorps SDCT1, anticorps Nadc1, anticorps mucin, anticorps mNaDC-1, anticorps INDY, anticorps nact, anticorps slc13a2, anticorps slc13a5, anticorps wu:fd51b01, anticorps wu:fi13d08, anticorps wu:fi31b05, anticorps zgc:55601, anticorps zgc:77607, anticorps solute carrier family 13 member 2, anticorps solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2, anticorps solute carrier family 13 member 5 L homeolog, anticorps SLC13A2, anticorps Slc13a2, anticorps slc13a5.L, anticorps slc13a2

Sujet: SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.

Poids moléculaire: 64 kDa (MW of target protein)