SLC39A12 anticorps

N° du produit ABIN635946

Détail du produit anti-SLC39A12 anticorps

Antigène: SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC39 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A12 Blocking Peptide, catalog no. 33R-5811, is also available for use as a blocking control in assays to test for specificity of this SLC39A12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A12

Antigène: SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))

Autre désignation: SLC39A12 (SLC39A12 Produits)

Synonymes: anticorps LZT-Hs8, anticorps ZIP-12, anticorps bA570F3.1, anticorps AW046938, anticorps Gm731, anticorps solute carrier family 39 member 12, anticorps solute carrier family 39 (zinc transporter), member 12, anticorps SLC39A12, anticorps Slc39a12, anticorps slc39a12

Sujet: SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.

Poids moléculaire: 73 kDa (MW of target protein)