SLC39A12 anticorps

N° du produit ABIN635946

Cet anticorps anti-SLC39A12 Polyclonal Lapin (ABIN635946) détecte spécifiquement SLC39A12 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SLC39A12 anticorps (ABIN635946)

Antigène: SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC39A12 anticorps

Purification: Affinity purified

Immunogène: SLC39 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A12 Blocking Peptide, (ABIN5616246), is also available for use as a blocking control in assays to test for specificity of this SLC39A12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A12

Antigène: SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))

Autre désignation: SLC39A12

Sujet: SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.

Poids moléculaire: 73 kDa (MW of target protein)