B4GALNT1 anticorps (N-Term)

N° du produit ABIN635951

Détail du produit anti-B4GALNT1 anticorps

Antigène: B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B4GALNT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: B4 GALNT1 antibody was raised against the N terminal of B4 ALNT1

Purification: Affinity purified

Immunogène: B4 GALNT1 antibody was raised using the N terminal of B4 ALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B4GALNT1 Blocking Peptide, catalog no. 33R-1441, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B4GALNT1

Antigène: B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))

Autre désignation: B4GALNT1 (B4GALNT1 Produits)

Synonymes: anticorps MGC53523, anticorps B4GALNT1, anticorps zgc:158609, anticorps GALGT, anticorps GALNACT, anticorps GalNAc-T, anticorps SPG26, anticorps 4933429D13Rik, anticorps Gal-NAc-T, anticorps GalNAcT, anticorps Galgt1, anticorps Ggm-2, anticorps Ggm2, anticorps beta-1,4-N-acetyl-galactosaminyl transferase 1 L homeolog, anticorps beta-1,4-N-acetyl-galactosaminyl transferase 1a, anticorps beta-1,4-N-acetyl-galactosaminyl transferase 1, anticorps Beta-1,4 N-acetylgalactosaminyltransferase 1, anticorps beta-1,4-N-acetyl-galactosaminyltransferase 1, anticorps b4galnt1.L, anticorps b4galnt1a, anticorps b4galnt1, anticorps b4gn1, anticorps B4GALNT1, anticorps B4galnt1

Sujet: GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids.

Poids moléculaire: 59 kDa (MW of target protein)