PI3 anticorps

N° du produit ABIN635953

Détail du produit anti-PI3 anticorps

Antigène: PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PI3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PI3 Blocking Peptide, catalog no. 33R-7825, is also available for use as a blocking control in assays to test for specificity of this PI3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PI3

Antigène: PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))

Autre désignation: PI3 (PI3 Produits)

Synonymes: anticorps ESI, anticorps SKALP, anticorps WAP3, anticorps WFDC14, anticorps cementoin, anticorps trappin-2, anticorps TRAPPIN-2, anticorps elafin, anticorps peptidase inhibitor 3, anticorps peptidase inhibitor 3, skin-derived (SKALP), anticorps PI3

Sujet: PI3 is an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. PI3 contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. PI3 belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.

Poids moléculaire: 6 kDa (MW of target protein)