TMEM187 anticorps (Middle Region)

N° du produit ABIN635956

Détail du produit anti-TMEM187 anticorps

Antigène: TMEM187 (Transmembrane Protein 187 (TMEM187))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM187 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM187 antibody was raised against the middle region of TMEM187

Purification: Affinity purified

Immunogène: TMEM187 antibody was raised using the middle region of TMEM187 corresponding to a region with amino acids ECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM187 Blocking Peptide, catalog no. 33R-2300, is also available for use as a blocking control in assays to test for specificity of this TMEM187 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM187 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM187

Antigène: TMEM187 (Transmembrane Protein 187 (TMEM187))

Autre désignation: TMEM187 (TMEM187 Produits)

Synonymes: anticorps si:dkey-9i23.7, anticorps TMEM187, anticorps CXorf12, anticorps DXS9878E, anticorps ITBA1, anticorps transmembrane protein 187, anticorps Transmembrane protein 187, anticorps LOC465934, anticorps TMEM187, anticorps tmem187, anticorps tm187

Sujet: TMEM187 is a multi-pass membrane protein. The exact function of TMEM187 remains unknown.

Poids moléculaire: 29 kDa (MW of target protein)