ST3GAL4 anticorps (Middle Region)

N° du produit ABIN635964

Détail du produit anti-ST3GAL4 anticorps

Antigène: ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST3GAL4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ST3 GAL4 antibody was raised against the middle region of ST3 AL4

Purification: Affinity purified

Immunogène: ST3 GAL4 antibody was raised using the middle region of ST3 AL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST3GAL4 Blocking Peptide, catalog no. 33R-2869, is also available for use as a blocking control in assays to test for specificity of this ST3GAL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST3GAL4

Antigène: ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))

Autre désignation: ST3GAL4 (ST3GAL4 Produits)

Synonymes: anticorps siat4c, anticorps im:7151092, anticorps zgc:158162, anticorps SIAT4C, anticorps CGS23, anticorps NANTA3, anticorps SAT3, anticorps SIAT4, anticorps ST3GalIV, anticorps STZ, anticorps ST3GAL-IV, anticorps Siat4c, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 4, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 4 L homeolog, anticorps st3gal4, anticorps ST3GAL4, anticorps St3gal4, anticorps st3gal4.L

Sujet: Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase, ST6GAL1.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process