TMED1 anticorps (Middle Region)

N° du produit ABIN635968

Cet anticorps Lapin Polyclonal détecte spécifiquement TMED1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TMED1 anticorps (Middle Region) (ABIN635968)

Antigène: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMED1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMED1 anticorps

Épitope: Middle Region

Specificité: TMED1 antibody was raised against the middle region of TMED1

Purification: Affinity purified

Immunogène: TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMED1 Blocking Peptide, (ABIN938481), is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMED1

Antigène: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Autre désignation: TMED1

Sujet: TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Poids moléculaire: 23 kDa (MW of target protein)