TMED1 anticorps (Middle Region)

N° du produit ABIN635968

Détail du produit anti-TMED1 anticorps

Antigène: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMED1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMED1 antibody was raised against the middle region of TMED1

Purification: Affinity purified

Immunogène: TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMED1 Blocking Peptide, catalog no. 33R-3095, is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMED1

Antigène: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Autre désignation: TMED1 (TMED1 Produits)

Synonymes: anticorps Il1rl1l, anticorps Ly84l, anticorps St2l, anticorps IL1RL1LG, anticorps Tp24, anticorps tmed1, anticorps zgc:92038, anticorps zgc:158680, anticorps transmembrane p24 trafficking protein 1, anticorps transmembrane p24 trafficking protein 1a, anticorps transmembrane p24 trafficking protein 1b, anticorps Tmed1, anticorps TMED1, anticorps tmed1a, anticorps tmed1b

Sujet: TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Poids moléculaire: 23 kDa (MW of target protein)