TMEM115 anticorps (N-Term)

N° du produit ABIN635970

Cet anticorps anti-TMEM115 est un anticorps Lapin Polyclonal détectant TMEM115 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour TMEM115 anticorps (N-Term) (ABIN635970)

Antigène: TMEM115 (Transmembrane Protein 115 (TMEM115))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM115 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM115 anticorps

Épitope: N-Term

Specificité: TMEM115 antibody was raised against the N terminal of TMEM115

Purification: Affinity purified

Immunogène: TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM115 Blocking Peptide, (ABIN5616658), is also available for use as a blocking control in assays to test for specificity of this TMEM115 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM115 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM115

Antigène: TMEM115 (Transmembrane Protein 115 (TMEM115))

Autre désignation: TMEM115

Sujet: The specific function of TMEM115 is not yet known.

Poids moléculaire: 38 kDa (MW of target protein)