Nurim anticorps
-
- Antigène Voir toutes Nurim (NRM) Anticorps
- Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Nurim est non-conjugé
- Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Nurim antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW
- Top Product
- Discover our top product NRM Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Nurim Blocking Peptide, catalog no. 33R-5708, is also available for use as a blocking control in assays to test for specificity of this Nurim antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))
- Autre désignation
- Nurim (NRM Produits)
- Synonymes
- anticorps NRM29, anticorps 2610307M02Rik, anticorps AI429796, anticorps si:dkey-263h23.2, anticorps nurim, anticorps nurim (nuclear envelope membrane protein), anticorps nurim L homeolog, anticorps NRM, anticorps Nrm, anticorps nrm.L, anticorps nrm
- Sujet
- The function of Nurim protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 29 kDa (MW of target protein)
-