ICMT anticorps (Middle Region)

N° du produit ABIN635975

Détail du produit anti-ICMT anticorps

Antigène: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ICMT est non-conjugé

Application: Western Blotting (WB)

Specificité: ICMT antibody was raised against the middle region of ICMT

Purification: Affinity purified

Immunogène: ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ICMT Blocking Peptide, catalog no. 33R-3574, is also available for use as a blocking control in assays to test for specificity of this ICMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ICMT

Antigène: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Autre désignation: ICMT (ICMT Produits)

Synonymes: anticorps HSTE14, anticorps MST098, anticorps MSTP098, anticorps PCCMT, anticorps PCMT, anticorps PPMT, anticorps 1700008E11Rik, anticorps C80758, anticorps Gm13095, anticorps OTTMUSG00000010406, anticorps STE14, anticorps pcCMT, anticorps fcmt, anticorps im:6895697, anticorps zgc:110258, anticorps isoprenylcysteine carboxyl methyltransferase, anticorps cobalt-zinc-cadmium resistance protein, anticorps Isoprenylcysteine carboxyl methyltransferase, anticorps isoprenylcysteine carboxylmethyltransferase family protein, anticorps isoprenylcysteine carboxyl methyltransferase S homeolog, anticorps ICMT, anticorps Icmt, anticorps icmt, anticorps Bcen_5417, anticorps Acid_0983, anticorps Bcenmc03_4825, anticorps RPIC_RS08670, anticorps Mesil_1887, anticorps Slip_1333, anticorps Deba_2487, anticorps Bresu_2161, anticorps MPET_RS04760, anticorps MPET_RS08305, anticorps Saut_0066, anticorps Intca_3523, anticorps Deima_2891, anticorps Despr_1203, anticorps Deipr_0831, anticorps Theth_0229, anticorps icmt.S

Sujet: ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.

Poids moléculaire: 32 kDa (MW of target protein)