DHRS7B anticorps

N° du produit ABIN635978

L’anticorps anti-DHRS7B Polyclonal Lapin est utilisé pour la détection de DHRS7B dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour DHRS7B anticorps (ABIN635978)

Antigène: DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHRS7B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DHRS7B anticorps

Purification: Affinity purified

Immunogène: DHRS7 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHRS7B Blocking Peptide, (ABIN5613195), is also available for use as a blocking control in assays to test for specificity of this DHRS7B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHRS7B

Antigène: DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))

Autre désignation: DHRS7B

Sujet: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.

Poids moléculaire: 35 kDa (MW of target protein)