A4GNT anticorps (C-Term)
-
- Antigène Voir toutes A4GNT Anticorps
- A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp A4GNT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- A4 GNT antibody was raised against the C terminal of A4 NT
- Purification
- Affinity purified
- Immunogène
- A4 GNT antibody was raised using the C terminal of A4 NT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
- Top Product
- Discover our top product A4GNT Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
A4GNT Blocking Peptide, catalog no. 33R-6732, is also available for use as a blocking control in assays to test for specificity of this A4GNT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 NT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))
- Autre désignation
- A4GNT (A4GNT Produits)
- Synonymes
- anticorps A4GNT, anticorps a4gnt, anticorps MGC116495, anticorps ALPHA4GNT, anticorps alpha4GnT, anticorps AV080780, anticorps Alpha4gnt, anticorps Gm798, anticorps alpha-1,4-N-acetylglucosaminyltransferase, anticorps alpha-1,4-N-acetylglucosaminyltransferase L homeolog, anticorps A4GNT, anticorps a4gnt, anticorps a4gnt.L, anticorps A4gnt
- Sujet
- A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.
- Poids moléculaire
- 39 kDa (MW of target protein)
-