IL1RL1 anticorps (N-Term)

N° du produit ABIN635984

Détail du produit anti-IL1RL1 anticorps

Antigène: IL1RL1 (Interleukin 1 Receptor-Like 1 (IL1RL1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL1RL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IL1 RL1 antibody was raised against the N terminal of IL1 L1

Purification: Affinity purified

Immunogène: IL1 RL1 antibody was raised using the N terminal of IL1 L1 corresponding to a region with amino acids RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL1RL1 Blocking Peptide, catalog no. 33R-8118, is also available for use as a blocking control in assays to test for specificity of this IL1RL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 L1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL1RL1

Antigène: IL1RL1 (Interleukin 1 Receptor-Like 1 (IL1RL1))

Autre désignation: IL1RL1 (IL1RL1 Produits)

Sujet: IL1RL1 is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.

Poids moléculaire: 61 kDa (MW of target protein)