TMEM9 anticorps (C-Term)

N° du produit ABIN635985

Détail du produit anti-TMEM9 anticorps

Antigène: TMEM9 (Transmembrane Protein 9 (TMEM9))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM9 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM9 antibody was raised against the C terminal of TMEM9

Purification: Affinity purified

Immunogène: TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM9 Blocking Peptide, catalog no. 33R-1863, is also available for use as a blocking control in assays to test for specificity of this TMEM9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM9

Antigène: TMEM9 (Transmembrane Protein 9 (TMEM9))

Autre désignation: TMEM9 (TMEM9 Produits)

Synonymes: anticorps fi33g11, anticorps wu:fi33g11, anticorps zgc:55432, anticorps TMEM9A, anticorps 1500015G18Rik, anticorps AW545782, anticorps transmembrane protein 9, anticorps tmem9, anticorps TMEM9, anticorps Tmem9

Sujet: TMEM9 belongs to the TMEM9 family. It may be involved in intracellular transport.

Poids moléculaire: 20 kDa (MW of target protein)