ARMCX3 anticorps (Middle Region)

N° du produit ABIN635988

Cet anticorps anti-ARMCX3 est un anticorps Lapin Polyclonal détectant ARMCX3 dans WB. Adapté pour Humain.

Aperçu rapide pour ARMCX3 anticorps (Middle Region) (ABIN635988)

Antigène: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARMCX3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ARMCX3 anticorps

Épitope: Middle Region

Specificité: ARMCX3 antibody was raised against the middle region of ARMCX3

Purification: Affinity purified

Immunogène: ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARMCX3 Blocking Peptide, (ABIN940334), is also available for use as a blocking control in assays to test for specificity of this ARMCX3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARMCX3

Antigène: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Autre désignation: ARMCX3

Sujet: ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.

Poids moléculaire: 42 kDa (MW of target protein)