ARMCX3 anticorps (Middle Region)
-
- Antigène Voir toutes ARMCX3 Anticorps
- ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ARMCX3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARMCX3 antibody was raised against the middle region of ARMCX3
- Purification
- Affinity purified
- Immunogène
- ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
- Top Product
- Discover our top product ARMCX3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARMCX3 Blocking Peptide, catalog no. 33R-4948, is also available for use as a blocking control in assays to test for specificity of this ARMCX3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))
- Autre désignation
- ARMCX3 (ARMCX3 Produits)
- Synonymes
- anticorps ALEX3, anticorps dJ545K15.2, anticorps 1200004E24Rik, anticorps AI450003, anticorps ARMCX3, anticorps DKFZp459E2029, anticorps armadillo repeat containing, X-linked 3, anticorps ARMCX3, anticorps Armcx3
- Sujet
- ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.
- Poids moléculaire
- 42 kDa (MW of target protein)
-