A4GALT anticorps

N° du produit ABIN635990

Détail du produit anti-A4GALT anticorps

Antigène: A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp A4GALT est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: A4 GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

A4GALT Blocking Peptide, catalog no. 33R-9678, is also available for use as a blocking control in assays to test for specificity of this A4GALT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 ALT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur A4GALT

Antigène: A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))

Autre désignation: A4GALT (A4GALT Produits)

Synonymes: anticorps A14GALT, anticorps A4GALT1, anticorps Gb3S, anticorps P(k), anticorps P1, anticorps P1PK, anticorps PK, anticorps Gb3, anticorps alpha 1,4-galactosyltransferase (P blood group), anticorps alpha 1,4-galactosyltransferase, anticorps A4GALT, anticorps A4galt

Sujet: The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system.

Poids moléculaire: 40 kDa (MW of target protein)