QPCTL anticorps (Middle Region)

N° du produit ABIN635992

Cet anticorps Lapin Polyclonal détecte spécifiquement QPCTL dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour QPCTL anticorps (Middle Region) (ABIN635992)

Antigène: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp QPCTL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-QPCTL anticorps

Épitope: Middle Region

Specificité: QPCTL antibody was raised against the middle region of QPCTL

Purification: Affinity purified

Immunogène: QPCTL antibody was raised using the middle region of QPCTL corresponding to a region with amino acids QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

QPCTL Blocking Peptide, (ABIN5615694), is also available for use as a blocking control in assays to test for specificity of this QPCTL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur QPCTL

Antigène: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Autre désignation: QPCTL

Sujet: QPCTL is a single-pass membrane proteinPotential. It belongs to the glutaminyl-peptide cyclotransferase family. The exact function of QPCTL remains unknown.

Poids moléculaire: 43 kDa (MW of target protein)