TMEM51 anticorps (N-Term)

N° du produit ABIN635996

L’anticorps Lapin Polyclonal anti-TMEM51 a été validé pour WB. Il convient pour détecter TMEM51 dans des échantillons de Humain.

Aperçu rapide pour TMEM51 anticorps (N-Term) (ABIN635996)

Antigène: TMEM51 (Transmembrane Protein 51 (TMEM51))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM51 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM51 anticorps

Épitope: N-Term

Specificité: TMEM51 antibody was raised against the N terminal of TMEM51

Purification: Affinity purified

Immunogène: TMEM51 antibody was raised using the N terminal of TMEM51 corresponding to a region with amino acids GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM51 Blocking Peptide, (ABIN938650), is also available for use as a blocking control in assays to test for specificity of this TMEM51 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM51 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM51

Antigène: TMEM51 (Transmembrane Protein 51 (TMEM51))

Autre désignation: TMEM51

Sujet: TMEM51 is a multi-pass membrane protein. The function of the TMEM51 protein remains unknown.

Poids moléculaire: 28 kDa (MW of target protein)