FLJ20674 (N-Term) anticorps

N° du produit ABIN636000

Cet anticorps anti-FLJ20674 Polyclonal Lapin (ABIN636000) détecte spécifiquement FLJ20674 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FLJ20674 (N-Term) anticorps (ABIN636000)

Antigène: FLJ20674

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: FLJ20674 antibody was raised against the N terminal of FLJ20674

Purification: Affinity purified

Immunogène: FLJ20674 antibody was raised using the N terminal of FLJ20674 corresponding to a region with amino acids LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ20674 Blocking Peptide, (ABIN5613608), is also available for use as a blocking control in assays to test for specificity of this FLJ20674 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20674 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: FLJ20674

Sujet: The function of FLJ20674 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 59 kDa (MW of target protein)