CASD1 anticorps (N-Term)

N° du produit ABIN636009

Cet anticorps anti-CASD1 est un anticorps Lapin Polyclonal détectant CASD1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour CASD1 anticorps (N-Term) (ABIN636009)

Antigène: CASD1 (CAS1 Domain Containing 1 (CASD1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CASD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CASD1 anticorps

Épitope: N-Term

Specificité: CASD1 antibody was raised against the N terminal of CASD1

Purification: Affinity purified

Immunogène: CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CASD1 Blocking Peptide, (ABIN5612629), is also available for use as a blocking control in assays to test for specificity of this CASD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CASD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CASD1

Antigène: CASD1 (CAS1 Domain Containing 1 (CASD1))

Autre désignation: CASD1

Sujet: The function of CASD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 91 kDa (MW of target protein)