SRD5A3 anticorps (N-Term)

N° du produit ABIN636011

L’anticorps Lapin Polyclonal anti-SRD5A3 a été validé pour WB. Il convient pour détecter SRD5A3 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour SRD5A3 anticorps (N-Term) (ABIN636011)

Antigène: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRD5A3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SRD5A3 anticorps

Épitope: N-Term

Specificité: SRD5 A3 antibody was raised against the N terminal of SRD5 3

Purification: Affinity purified

Immunogène: SRD5 A3 antibody was raised using the N terminal of SRD5 3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRD5A3 Blocking Peptide, (ABIN938794), is also available for use as a blocking control in assays to test for specificity of this SRD5A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRD5A3

Antigène: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Autre désignation: SRD5A3

Sujet: SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis