SRD5A3 anticorps (N-Term)

N° du produit ABIN636011

Détail du produit anti-SRD5A3 anticorps

Antigène: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRD5A3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SRD5 A3 antibody was raised against the N terminal of SRD5 3

Purification: Affinity purified

Immunogène: SRD5 A3 antibody was raised using the N terminal of SRD5 3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRD5A3 Blocking Peptide, catalog no. 33R-3408, is also available for use as a blocking control in assays to test for specificity of this SRD5A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRD5A3

Antigène: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Autre désignation: SRD5A3 (SRD5A3 Produits)

Synonymes: anticorps CDG1P, anticorps CDG1Q, anticorps KRIZI, anticorps SRD5A2L, anticorps SRD5A2L1, anticorps 1110025P14Rik, anticorps A430076C09, anticorps AV364670, anticorps AW987574, anticorps D730040M03Rik, anticorps H5ar, anticorps S5AR 3, anticorps Srd5a2l, anticorps RGD1308828, anticorps SRD5alpha3, anticorps steroid 5 alpha-reductase 3, anticorps steroid 5 alpha-reductase 3 S homeolog, anticorps SRD5A3, anticorps Srd5a3, anticorps srd5a3.S

Sujet: SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis