TXNDC15 anticorps (C-Term)

N° du produit ABIN636013

Cet anticorps Lapin Polyclonal détecte spécifiquement TXNDC15 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TXNDC15 anticorps (C-Term) (ABIN636013)

Antigène: TXNDC15 (Thioredoxin Domain Containing 15 (TXNDC15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TXNDC15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TXNDC15 anticorps

Épitope: C-Term

Specificité: TXNDC15 antibody was raised against the C terminal of TXNDC15

Purification: Affinity purified

Immunogène: TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TXNDC15 Blocking Peptide, (ABIN5616851), is also available for use as a blocking control in assays to test for specificity of this TXNDC15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TXNDC15

Antigène: TXNDC15 (Thioredoxin Domain Containing 15 (TXNDC15))

Autre désignation: TXNDC15

Sujet: TXNDC15 is a single-pass type I membrane protein. It contains 1 thioredoxin domain.

Poids moléculaire: 40 kDa (MW of target protein)