UGT2A3 anticorps (N-Term)

N° du produit ABIN636014

L’anticorps Lapin Polyclonal anti-UGT2A3 a été validé pour WB. Il convient pour détecter UGT2A3 dans des échantillons de Humain.

Aperçu rapide pour UGT2A3 anticorps (N-Term) (ABIN636014)

Antigène: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT2A3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UGT2A3 anticorps

Épitope: N-Term

Specificité: UGT2 A3 antibody was raised against the N terminal of µgT2 3

Purification: Affinity purified

Immunogène: UGT2 A3 antibody was raised using the N terminal of µgT2 3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT2A3 Blocking Peptide, (ABIN5616902), is also available for use as a blocking control in assays to test for specificity of this µgT2A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT2A3

Antigène: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Autre désignation: UGT2A3

Sujet: UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis