UXS1 anticorps (Middle Region)

N° du produit ABIN636016

Détail du produit anti-UXS1 anticorps

Antigène: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UXS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: UXS1 antibody was raised against the middle region of UXS1

Purification: Affinity purified

Immunogène: UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UXS1 Blocking Peptide, catalog no. 33R-5205, is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UXS1

Antigène: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Autre désignation: UXS1 (UXS1 Produits)

Sujet: UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process