GLT8D2 anticorps (C-Term)

N° du produit ABIN636017

L’anticorps Lapin Polyclonal anti-GLT8D2 a été validé pour WB. Il convient pour détecter GLT8D2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour GLT8D2 anticorps (C-Term) (ABIN636017)

Antigène: GLT8D2 (Glycosyltransferase 8 Domain Containing 2 (GLT8D2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLT8D2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GLT8D2 anticorps

Épitope: C-Term

Specificité: GLT8 D2 antibody was raised against the C terminal of GLT8 2

Purification: Affinity purified

Immunogène: GLT8 D2 antibody was raised using the C terminal of GLT8 2 corresponding to a region with amino acids IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLT8D2 Blocking Peptide, (ABIN939517), is also available for use as a blocking control in assays to test for specificity of this GLT8D2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLT8D2

Antigène: GLT8D2 (Glycosyltransferase 8 Domain Containing 2 (GLT8D2))

Autre désignation: GLT8D2

Sujet: GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown.

Poids moléculaire: 40 kDa (MW of target protein)