Aquaporin 10 anticorps (C-Term)

N° du produit ABIN636023

Détail du produit anti-Aquaporin 10 anticorps

Antigène: Aquaporin 10 (AQP10)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aquaporin 10 est non-conjugé

Application: Western Blotting (WB)

Specificité: Aquaporin 10 antibody was raised against the C terminal of AQP10

Purification: Affinity purified

Immunogène: Aquaporin 10 antibody was raised using the C terminal of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Aquaporin 10 Blocking Peptide, catalog no. 33R-9546, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Aquaporin 10

Antigène: Aquaporin 10 (AQP10)

Autre désignation: Aquaporin 10 (AQP10 Produits)

Synonymes: anticorps aqp10, anticorps zgc:92167, anticorps AQP10, anticorps AQPA_HUMAN, anticorps aquaporin 10a, anticorps aquaporin 10, anticorps similar to aquaporin 10, anticorps aqp10a, anticorps AQP10, anticorps LOC686596

Sujet: AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.

Poids moléculaire: 32 kDa (MW of target protein)