PON3 anticorps (Middle Region)

N° du produit ABIN636029

Détail du produit anti-PON3 anticorps

Antigène: PON3 (Paraoxonase 3 (PON3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PON3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PON3 antibody was raised against the middle region of PON3

Purification: Affinity purified

Immunogène: PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PON3 Blocking Peptide, catalog no. 33R-7223, is also available for use as a blocking control in assays to test for specificity of this PON3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PON3

Antigène: PON3 (Paraoxonase 3 (PON3))

Autre désignation: PON3 (PON3 Produits)

Synonymes: anticorps 2810004E20, anticorps AI786302, anticorps paraoxonase 3, anticorps PON3, anticorps Pon3

Sujet: This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL).

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process