Prolipoprotein Diacylglyceryl Transferase anticorps (C-Term)

N° du produit ABIN636039

Cet anticorps anti-Prolipoprotein Diacylglyceryl Transferase est un anticorps Lapin Polyclonal détectant Prolipoprotein Diacylglyceryl Transferase dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour Prolipoprotein Diacylglyceryl Transferase anticorps (C-Term) (ABIN636039)

Antigène: Prolipoprotein Diacylglyceryl Transferase (IGT)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Prolipoprotein Diacylglyceryl Transferase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Prolipoprotein Diacylglyceryl Transferase anticorps

Épitope: C-Term

Specificité: PIGT antibody was raised against the C terminal of PIGT

Purification: Affinity purified

Immunogène: PIGT antibody was raised using the C terminal of PIGT corresponding to a region with amino acids LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGT Blocking Peptide, (ABIN5615371), is also available for use as a blocking control in assays to test for specificity of this PIGT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Prolipoprotein Diacylglyceryl Transferase

Antigène: Prolipoprotein Diacylglyceryl Transferase (IGT)

Autre désignation: IGT

Sujet: PIGT is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.

Poids moléculaire: 64 kDa (MW of target protein)