Receptor Accessory Protein 1 anticorps (C-Term)

N° du produit ABIN636040

Cet anticorps Lapin Polyclonal détecte spécifiquement Receptor Accessory Protein 1 dans WB. Il présente une réactivité envers Humain et Rat.

Aperçu rapide pour Receptor Accessory Protein 1 anticorps (C-Term) (ABIN636040)

Antigène: Receptor Accessory Protein 1 (REEP1)

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Receptor Accessory Protein 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Receptor Accessory Protein 1 anticorps

Épitope: C-Term

Specificité: REEP1 antibody was raised against the C terminal of REEP1

Purification: Affinity purified

Immunogène: REEP1 antibody was raised using the C terminal of REEP1 corresponding to a region with amino acids ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

REEP1 Blocking Peptide, (ABIN938090), is also available for use as a blocking control in assays to test for specificity of this REEP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Receptor Accessory Protein 1

Antigène: Receptor Accessory Protein 1 (REEP1)

Autre désignation: REEP1

Sujet: REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.

Poids moléculaire: 22 kDa (MW of target protein)