GDE1 anticorps (N-Term)

N° du produit ABIN636050

L’anticorps anti-GDE1 Polyclonal Lapin est utilisé pour la détection de GDE1 dans des échantillons de Humain, Rat, Souris et Chien. Il a été validé pour WB et IHC.

Aperçu rapide pour GDE1 anticorps (N-Term) (ABIN636050)

Antigène: GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GDE1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-GDE1 anticorps

Épitope: N-Term

Specificité: GDE1 antibody was raised against the N terminal Of Gde1

Purification: Affinity purified

Immunogène: GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GDE1 Blocking Peptide, (ABIN5613744), is also available for use as a blocking control in assays to test for specificity of this GDE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GDE1

Antigène: GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))

Autre désignation: GDE1

Sujet: GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.

Poids moléculaire: 38 kDa (MW of target protein)