Arylsulfatase E anticorps

N° du produit ABIN636061

Détail du produit anti-Arylsulfatase E anticorps

Antigène: Arylsulfatase E (ARSE)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Arylsulfatase E est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ARSE antibody was raised using a synthetic peptide corresponding to a region with amino acids KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARSE Blocking Peptide, catalog no. 33R-4727, is also available for use as a blocking control in assays to test for specificity of this ARSE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Arylsulfatase E

Antigène: Arylsulfatase E (ARSE)

Autre désignation: ARSE (ARSE Produits)

Synonymes: anticorps ASE, anticorps CDPX, anticorps CDPX1, anticorps CDPXR, anticorps ARSE, anticorps MGC155058, anticorps arylsulfatase E (chondrodysplasia punctata 1), anticorps arylsulfatase E, anticorps ARSE, anticorps Arse

Sujet: Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.

Poids moléculaire: 62 kDa (MW of target protein)