RHCE anticorps (N-Term)

N° du produit ABIN636066

Détail du produit anti-RHCE anticorps

Antigène: RHCE (Rhesus Blood Group, CcEe Antigens (RHCE))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHCE est non-conjugé

Application: Western Blotting (WB)

Specificité: RHCE antibody was raised against the N terminal of RHCE

Purification: Affinity purified

Immunogène: RHCE antibody was raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHCE Blocking Peptide, catalog no. 33R-8819, is also available for use as a blocking control in assays to test for specificity of this RHCE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHCE

Antigène: RHCE (Rhesus Blood Group, CcEe Antigens (RHCE))

Autre désignation: RHCE (RHCE Produits)

Synonymes: anticorps CD240CE, anticorps RH, anticorps RH30A, anticorps RHC, anticorps RHE, anticorps RHIXB, anticorps RHPI, anticorps Rh4, anticorps RhIVb(J), anticorps RhVI, anticorps RhVIII, anticorps RHCE, anticorps Rh blood group CcEe antigens, anticorps Rh blood group, CcEe antigens, anticorps RHCE

Sujet: The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease.

Poids moléculaire: 29 kDa (MW of target protein)