Parathyroid Hormone 2 (PTH2) (Middle Region) anticorps

N° du produit ABIN636078

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans WB. Adapté pour Hormone.

Aperçu rapide pour Parathyroid Hormone 2 (PTH2) (Middle Region) anticorps (ABIN636078)

Antigène: Parathyroid Hormone 2 (PTH2)

Reactivité: Hormone

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: Middle Region

Specificité: PTH2 antibody was raised against the middle region of PTH2

Purification: Affinity purified

Immunogène: PTH2 antibody was raised using the middle region of PTH2 corresponding to a region with amino acids WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTH2 Blocking Peptide, (ABIN5615656), is also available for use as a blocking control in assays to test for specificity of this PTH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Parathyroid Hormone 2 (PTH2)

Autre désignation: PTH2

Classe de substances: Hormone

Sujet: TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.

Poids moléculaire: 11 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development